PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G333000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family bHLH
Protein Properties Length: 96aa    MW: 10622.9 Da    PI: 9.3634
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G333000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH32.12.1e-1022621454
                       HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                       d+iN+  ++L++llP++ + +s K+s a +L+++++YI++L
  Aqcoe3G333000.1.p 22 DQINDLVSKLQQLLPELRNRSSDKVSSAKVLQETCNYIRNL 62
                       79**************879********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.509862IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.8E-82262IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.11E-102283IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.1E-102277IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MSSRRSRSSR QSSSGGSRIT DDQINDLVSK LQQLLPELRN RSSDKVSSAK VLQETCNYIR  60
NLHREVDDLS ERLSELLATT DTSSAQAAII RSLLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389574.12e-44PREDICTED: transcription factor ILI6-like
SwissprotB8APB57e-39ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR27e-39ILI6_ORYSJ; Transcription factor ILI6
SwissprotQ8GW326e-39PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A151RGX82e-44A0A151RGX8_CAJCA; Transcription factor bHLH135 family
STRINGGSMUA_Achr2P07410_0017e-44(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.17e-40bHLH family protein